JaMBW Chapter 3.1.2

Feature Viewer


This program, given a sequence and the features which are contained in it produce a graphical display of them which allows to jump between features, sequence and full text of the feature.

Notes:

To include this applet in your page, do as follow:
<applet code=FeatureTable.class width=800 height=200>
<param name=ID value=GHR_PIG>
<param name=RAW value=MDLWQLLLTLAVAGSSDAFSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFS>
<param name=FT value=SIGNAL+1+18+something|CHAIN+19+638+GROWTH_HORMONE_RECEPTOR|DOMAIN+9+264+EXTRACELLULAR_(POTENTIAL)|>

Inspired by Thure ETZOLD for his Sequence Retrieval System, completely written in Java by Luca TOLDO and freely distributable.

Date:7 June 1996, Author:Luca Toldo